PDB entry 4e37

View 4e37 on RCSB PDB site
Description: Crystal Structure of P. aeruginosa catalase, KatA tetramer
Class: oxidoreductase
Keywords: Catalase, OXIDOREDUCTASE
Deposited on 2012-03-09, released 2013-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.176
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: katA, PA4236
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e37a_
  • Chain 'B':
    Compound: catalase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: katA, PA4236
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e37b_
  • Chain 'C':
    Compound: catalase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: katA, PA4236
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e37c_
  • Chain 'D':
    Compound: catalase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: katA, PA4236
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e37d_
  • Heterogens: HEM, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e37A (A:)
    ektrlttaagapvvdnqnvqtagprgpmllqdvwfleklahfdreviperrmhakgsaay
    gtftvthditpytrakifsqvgkktdmflrfstvagergaadaerdirgfsmrfyteqgn
    wdlvgnntpvfylrdplkfpdlnhvvkrdprtnlrnatfkwdffshlpeslhqltidfsd
    rglpksyrhihgfgshtfsfinannerfwvkfhfktqqgienltnaeaaeviaqdressq
    rdlyesiekgdfprwkmyvqimpekeaatyrynpfdltkvwphgdyplievgffelnrnp
    dnyfaeveqaaftpanvvpgigfspdkmlqgrlfsygdahryrlgvnhhqipvnaarcph
    qvyhrdggmrvdgnnahqrvtyepnsfnqwqeqpdfsepplslegaadhwnhrvdddyys
    qpaalfhlftdeqkqrlfaniaedirdvpeqiqrrqiglflkvdpaygkgvadalglkld
    aahh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e37A (A:)
    ektrlttaagapvvdnqnvqtagprgpmllqdvwfleklahfdreviperrmhakgsaay
    gtftvthditpytrakifsqvgkktdmflrfstvagergaadaerdirgfsmrfyteqgn
    wdlvgnntpvfylrdplkfpdlnhvvkrdprtnlrnatfkwdffshlpeslhqltidfsd
    rglpksyrhihgfgshtfsfinannerfwvkfhfktqqgienltnaeaaeviaqdressq
    rdlyesiekgdfprwkmyvqimpekeaatyrynpfdltkvwphgdyplievgffelnrnp
    dnyfaeveqaaftpanvvpgigfspdkmlqgrlfsygdahryrlgvnhhqipvnaarcph
    qvyhrdggmrvdgnnahqrvtyepnsfnqwqeqpdfsepplslegaadhwnhrvdddyys
    qpaalfhlftdeqkqrlfaniaedirdvpeqiqrrqiglflkvdpaygkgvadalglkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e37B (B:)
    ektrlttaagapvvdnqnvqtagprgpmllqdvwfleklahfdreviperrmhakgsaay
    gtftvthditpytrakifsqvgkktdmflrfstvagergaadaerdirgfsmrfyteqgn
    wdlvgnntpvfylrdplkfpdlnhvvkrdprtnlrnatfkwdffshlpeslhqltidfsd
    rglpksyrhihgfgshtfsfinannerfwvkfhfktqqgienltnaeaaeviaqdressq
    rdlyesiekgdfprwkmyvqimpekeaatyrynpfdltkvwphgdyplievgffelnrnp
    dnyfaeveqaaftpanvvpgigfspdkmlqgrlfsygdahryrlgvnhhqipvnaarcph
    qvyhrdggmrvdgnnahqrvtyepnsfnqwqeqpdfsepplslegaadhwnhrvdddyys
    qpaalfhlftdeqkqrlfaniaedirdvpeqiqrrqiglflkvdpaygkgvadalglkld
    aahh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e37B (B:)
    ektrlttaagapvvdnqnvqtagprgpmllqdvwfleklahfdreviperrmhakgsaay
    gtftvthditpytrakifsqvgkktdmflrfstvagergaadaerdirgfsmrfyteqgn
    wdlvgnntpvfylrdplkfpdlnhvvkrdprtnlrnatfkwdffshlpeslhqltidfsd
    rglpksyrhihgfgshtfsfinannerfwvkfhfktqqgienltnaeaaeviaqdressq
    rdlyesiekgdfprwkmyvqimpekeaatyrynpfdltkvwphgdyplievgffelnrnp
    dnyfaeveqaaftpanvvpgigfspdkmlqgrlfsygdahryrlgvnhhqipvnaarcph
    qvyhrdggmrvdgnnahqrvtyepnsfnqwqeqpdfsepplslegaadhwnhrvdddyys
    qpaalfhlftdeqkqrlfaniaedirdvpeqiqrrqiglflkvdpaygkgvadalglkld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e37C (C:)
    ektrlttaagapvvdnqnvqtagprgpmllqdvwfleklahfdreviperrmhakgsaay
    gtftvthditpytrakifsqvgkktdmflrfstvagergaadaerdirgfsmrfyteqgn
    wdlvgnntpvfylrdplkfpdlnhvvkrdprtnlrnatfkwdffshlpeslhqltidfsd
    rglpksyrhihgfgshtfsfinannerfwvkfhfktqqgienltnaeaaeviaqdressq
    rdlyesiekgdfprwkmyvqimpekeaatyrynpfdltkvwphgdyplievgffelnrnp
    dnyfaeveqaaftpanvvpgigfspdkmlqgrlfsygdahryrlgvnhhqipvnaarcph
    qvyhrdggmrvdgnnahqrvtyepnsfnqwqeqpdfsepplslegaadhwnhrvdddyys
    qpaalfhlftdeqkqrlfaniaedirdvpeqiqrrqiglflkvdpaygkgvadalglkld
    aahh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e37C (C:)
    ktrlttaagapvvdnqnvqtagprgpmllqdvwfleklahfdreviperrmhakgsaayg
    tftvthditpytrakifsqvgkktdmflrfstvagergaadaerdirgfsmrfyteqgnw
    dlvgnntpvfylrdplkfpdlnhvvkrdprtnlrnatfkwdffshlpeslhqltidfsdr
    glpksyrhihgfgshtfsfinannerfwvkfhfktqqgienltnaeaaeviaqdressqr
    dlyesiekgdfprwkmyvqimpekeaatyrynpfdltkvwphgdyplievgffelnrnpd
    nyfaeveqaaftpanvvpgigfspdkmlqgrlfsygdahryrlgvnhhqipvnaarcphq
    vyhrdggmrvdgnnahqrvtyepnsfnqwqeqpdfsepplslegaadhwnhrvdddyysq
    paalfhlftdeqkqrlfaniaedirdvpeqiqrrqiglflkvdpaygkgvadalglkld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e37D (D:)
    ektrlttaagapvvdnqnvqtagprgpmllqdvwfleklahfdreviperrmhakgsaay
    gtftvthditpytrakifsqvgkktdmflrfstvagergaadaerdirgfsmrfyteqgn
    wdlvgnntpvfylrdplkfpdlnhvvkrdprtnlrnatfkwdffshlpeslhqltidfsd
    rglpksyrhihgfgshtfsfinannerfwvkfhfktqqgienltnaeaaeviaqdressq
    rdlyesiekgdfprwkmyvqimpekeaatyrynpfdltkvwphgdyplievgffelnrnp
    dnyfaeveqaaftpanvvpgigfspdkmlqgrlfsygdahryrlgvnhhqipvnaarcph
    qvyhrdggmrvdgnnahqrvtyepnsfnqwqeqpdfsepplslegaadhwnhrvdddyys
    qpaalfhlftdeqkqrlfaniaedirdvpeqiqrrqiglflkvdpaygkgvadalglkld
    aahh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e37D (D:)
    ektrlttaagapvvdnqnvqtagprgpmllqdvwfleklahfdreviperrmhakgsaay
    gtftvthditpytrakifsqvgkktdmflrfstvagergaadaerdirgfsmrfyteqgn
    wdlvgnntpvfylrdplkfpdlnhvvkrdprtnlrnatfkwdffshlpeslhqltidfsd
    rglpksyrhihgfgshtfsfinannerfwvkfhfktqqgienltnaeaaeviaqdressq
    rdlyesiekgdfprwkmyvqimpekeaatyrynpfdltkvwphgdyplievgffelnrnp
    dnyfaeveqaaftpanvvpgigfspdkmlqgrlfsygdahryrlgvnhhqipvnaarcph
    qvyhrdggmrvdgnnahqrvtyepnsfnqwqeqpdfsepplslegaadhwnhrvdddyys
    qpaalfhlftdeqkqrlfaniaedirdvpeqiqrrqiglflkvdpaygkgvadalglkld