PDB entry 4e31

View 4e31 on RCSB PDB site
Description: X-ray Structure of the Y76F mutant of TcaB9, a C-3'-Methyltransferase, in Complex with S-Adenosyl-L-Homocysteine and Sugar Product
Class: transferase
Keywords: kijanose, tetronitrose, tetradeoxy sugar, keto sugar, sugar methylation, TRANSFERASE
Deposited on 2012-03-09, released 2012-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.167
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TcaB9
    Species: Micromonospora chalcea [TaxId:1874]
    Gene: tcab9
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5L6K6 (Start-415)
      • engineered mutation (77)
    Domains in SCOPe 2.07: d4e31a_
  • Heterogens: ZN, EDO, SAH, JHZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e31A (A:)
    ghmshladvspptacrvcgggvqefldlgrqplsdrfrkpdelddeftyrlavgrcdsce
    mvqlteevprdlmfhevfpyhssgssvmrehfamlardflateltgpdpfiveigcndgi
    mlrtiqeagvrhlgfepssgvaakarekgirvrtdffekataddvrrtegpanviyaant
    lchipyvqsvlegvdallapdgvfvfedpylgdivaktsfdqiydehfflfsatsvqgma
    qrcgfelvdvqrlpvhggevrytlarqgsrtpsaavaqllaaereqelsdmatlrafagn
    vvkirdeltallhrlraegrsvvgygataksatvtnfcgigpdlvhsvydttpdkqnrlt
    pgahipvrpasafsdpypdyallfawnhaeeimakeqefhqaggrwilyvpevhir
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e31A (A:)
    tacrvcgggvqefldlgrqplsdrfrkpdelddeftyrlavgrcdscemvqlteevprdl
    mfhevfpyhssgssvmrehfamlardflateltgpdpfiveigcndgimlrtiqeagvrh
    lgfepssgvaakarekgirvrtdffekataddvrrtegpanviyaantlchipyvqsvle
    gvdallapdgvfvfedpylgdivaktsfdqiydehfflfsatsvqgmaqrcgfelvdvqr
    lpvhggevrytlarqgsrtpsaavaqllaaereqelsdmatlrafagnvvkirdeltall
    hrlraegrsvvgygataksatvtnfcgigpdlvhsvydttpdkqnrltpgahipvrpasa
    fsdpypdyallfawnhaeeimakeqefhqaggrwilyvpevhir