PDB entry 4e2s

View 4e2s on RCSB PDB site
Description: Crystal structure of (S)-Ureidoglycine Aminohydrolase from Arabidopsis thaliana in complex with its substrate, (S)-Ureidoglycine
Class: hydrolase
Keywords: bi-cupin, (S)-Ureidoglycine Aminohydrolase, Manganese Binding, Endoplasmic Reticulumn, HYDROLASE
Deposited on 2012-03-09, released 2012-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.209
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sa_
  • Chain 'B':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sb_
  • Chain 'C':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sc_
  • Chain 'D':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sd_
  • Chain 'E':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2se_
  • Chain 'F':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sf_
  • Chain 'G':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sg_
  • Chain 'H':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sh_
  • Chain 'I':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2si_
  • Chain 'J':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sj_
  • Chain 'K':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sk_
  • Chain 'L':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sl_
  • Chain 'M':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sm_
  • Chain 'N':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sn_
  • Chain 'O':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2so_
  • Chain 'P':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e2sp_
  • Heterogens: MN, UGY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e2sA (A:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sA (A:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e2sB (B:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sB (B:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e2sC (C:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sC (C:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e2sD (D:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sD (D:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4e2sE (E:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sE (E:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4e2sF (F:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sF (F:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4e2sG (G:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sG (G:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4e2sH (H:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sH (H:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4e2sI (I:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sI (I:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4e2sJ (J:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sJ (J:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4e2sK (K:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sK (K:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4e2sL (L:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sL (L:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4e2sM (M:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sM (M:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4e2sN (N:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sN (N:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4e2sO (O:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sO (O:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4e2sP (P:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2sP (P:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl