PDB entry 4e2q

View 4e2q on RCSB PDB site
Description: Crystal Structure of (S)-Ureidoglycine Aminohydrolase from Arabidopsis thaliana
Class: hydrolase
Keywords: Bi-Cupin, Aminohydrolase, Manganese Binding, Endoplasmic Reticulum, HYDROLASE
Deposited on 2012-03-09, released 2012-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qa_
  • Chain 'B':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qb_
  • Chain 'C':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qc_
  • Chain 'D':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qd_
  • Chain 'E':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qe_
  • Chain 'F':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qf_
  • Chain 'G':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qg_
  • Chain 'H':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qh_
  • Chain 'I':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qi_
  • Chain 'J':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qj_
  • Chain 'K':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qk_
  • Chain 'L':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2ql_
  • Chain 'M':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qm_
  • Chain 'N':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qn_
  • Chain 'O':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qo_
  • Chain 'P':
    Compound: Ureidoglycine aminohydrolase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ylbA, UGLYAH, At4g17050, AT4G17050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e2qp_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e2qA (A:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qA (A:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e2qB (B:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qB (B:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e2qC (C:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qC (C:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e2qD (D:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qD (D:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4e2qE (E:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qE (E:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4e2qF (F:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qF (F:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4e2qG (G:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qG (G:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4e2qH (H:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qH (H:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4e2qI (I:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qI (I:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4e2qJ (J:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qJ (J:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4e2qK (K:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qK (K:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4e2qL (L:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qL (L:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4e2qM (M:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qM (M:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4e2qN (N:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qN (N:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4e2qO (O:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qO (O:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4e2qP (P:)
    ghmktnpiywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgay
    litpatgshfvmylakmkemsssglppqdierlifvvegavtltntsssskkltvdsyay
    lppnfhhsldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpm
    svaydfnihtmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapf
    vpqwyaalgktrsryllykdvnrnpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e2qP (P:)
    piywkatnptlspshlqdlpgftrsvykrdhalitpeshvysplpdwtntlgaylitpat
    gshfvmylakmkemsssglppqdierlifvvegavtltnssskkltvdsyaylppnfhhs
    ldcvesatlvvferryeylgshttelivgstdkqplletpgevfelrkllpmsvaydfni
    htmdfqpgeflnvkevhynqhgllllegqgiyrlgdnwypvqagdviwmapfvpqwyaal
    gktrsryllykdvnrnpl