PDB entry 4e26

View 4e26 on RCSB PDB site
Description: BRAF in complex with an organic inhibitor 7898734
Class: transferase/transferase inhibitor
Keywords: kinase, inhibitor, oncoprotein, melanoma, transferase-transferase inhibitor complex
Deposited on 2012-03-07, released 2012-05-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4e26a_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4e26b_
  • Heterogens: 734, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e26A (A:)
    mdrgshhhhhhgsedrnrmktlgrrdssddweipdgqitvgqrigsgsfgtvykgkwhgd
    vavkmlnvtaptpqqlqafknevgvlrktrhvnillfmgystkpqlaivtqwcegsslyh
    hlhiietkfemiklidiarqtaqgmdylhaksiihrdlksnniflhedltvkigdfglat
    vksrwsgshqfeqlsgsilwmapevirmqdknpysfqsdvyafgivlyelmtgqlpysni
    nnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfpqilasiellar
    slpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e26A (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksrfeqlsgsilwmapevirmqdknpy
    sfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlm
    aeclkkkrderplfpqilasiellarslpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e26B (B:)
    mdrgshhhhhhgsedrnrmktlgrrdssddweipdgqitvgqrigsgsfgtvykgkwhgd
    vavkmlnvtaptpqqlqafknevgvlrktrhvnillfmgystkpqlaivtqwcegsslyh
    hlhiietkfemiklidiarqtaqgmdylhaksiihrdlksnniflhedltvkigdfglat
    vksrwsgshqfeqlsgsilwmapevirmqdknpysfqsdvyafgivlyelmtgqlpysni
    nnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrderplfpqilasiellar
    slpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e26B (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvkssgsilwmapevirmqdknpysfqsd
    vyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclk
    kkrderplfpqilasiellarslp