PDB entry 4e20

View 4e20 on RCSB PDB site
Description: Structure of mouse Tyk-2 complexed to a 3-aminoindazole inhibitor
Class: transferase/transferase inhibitor
Keywords: kinase catalytic domain, kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-03-07, released 2012-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-receptor tyrosine-protein kinase TYK2
    Species: Mus musculus [TaxId:10090]
    Gene: TYK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R117 (0-289)
      • engineered mutation (135)
    Domains in SCOPe 2.06: d4e20a_
  • Heterogens: 0MY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e20A (A:)
    dptvfhkrylkkirdlgeghfgkvslycydptndgtgemvavkalkegcgpqlrsgwqre
    ieilrtlyhehivkykgccedqgeksvqlvmeyvplgslrdylprhcvglaqlllfaqqi
    cegmaylhaqhyihralaarnvlldndrlvkigdfglakavpegheyyrvredgdspvfw
    yapeclkeckfyyasdvwsfgvtlyelltycdsnqsphtkftelightqgqmtvlrltel
    lergerlprpdrcpceiyhlmkncweteasfrptfqnlvpilqtaqekyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e20A (A:)
    dptvfhkrylkkirdlgeghfgkvslycydptndgtgemvavkalkegcgpqlrsgwqre
    ieilrtlyhehivkykgccedsvqlvmeyvplgslrdylprhcvglaqlllfaqqicegm
    aylhaqhyihralaarnvlldndrlvkigdfglakavpegheyyrvredgdspvfwyape
    clkeckfyyasdvwsfgvtlyelltycdsnqsphtkfteligqmtvlrltellergerlp
    rpdrcpceiyhlmkncweteasfrptfqnlvpilqtaqekyq