PDB entry 4e1k

View 4e1k on RCSB PDB site
Description: GlmU in complex with a Quinazoline Compound
Class: transferase/transferase inhibitor
Keywords: peptidoglycan synthesis, cell shape, metal-binding, cell wall biogenesis/degradation, multifunctional enzyme, acyltransferase, uridyltransferase, Nucleotidyl transferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-03-06, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.247
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Haemophilus influenzae [TaxId:71421]
    Gene: glmU, HI_0642
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e1ka1, d4e1ka2
  • Heterogens: SO4, PG4, 0N5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e1kA (A:)
    mtkkalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggd
    lmrthlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketlekliea
    kpengialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasf
    kkwlarvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfq
    nkqasklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlkn
    vvigndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgsk
    vnhltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangat
    igagttitrdvgenelvitrvaqrhiqgwqrpikkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e1kA (A:)
    kalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggdlmr
    thlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketleklieakpe
    ngialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasfkkw
    larvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfqnkq
    asklllegvmiydparfdlrgtlehgkdveidvnviiegnvklgdrvkigtgcvlknvvi
    gndveikpysvledsivgekaaigpfsrlrpgaelaaethvgnfveikkstvgkgskvnh
    ltyvgdseigsncnigagvitcnydgankfktiigddvfvgsdtqlvapvkvangatiga
    gttitrdvgenelvitrvaqrhiqgwqrpi