PDB entry 4e1a

View 4e1a on RCSB PDB site
Description: Phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis at 1.62A resolution
Class: transferase
Keywords: transferase
Deposited on 2012-03-06, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.173
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: coaD, kdtB, Rv2965c, MT3043, MTCY349.22, u0002e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e1aa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e1aA (A:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
    lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    rysfvssslakevamlggdvsellpepvnrrlrdrlntert
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e1aA (A:)
    mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
    lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
    rysfvssslakevamlggdvsellpepvnrrlrdrln