PDB entry 4e0c

View 4e0c on RCSB PDB site
Description: 1.8 Angstrom Resolution Crystal Structure of Transaldolase from Francisella tularensis (phosphate-free)
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, Alpha-Beta Barrel/TIM Barrel, TRANSFERASE
Deposited on 2012-03-02, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.153
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transaldolase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_1093c, talA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e0ca_
  • Chain 'B':
    Compound: Transaldolase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_1093c, talA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e0cb_
  • Heterogens: MG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e0cA (A:)
    mhhhhhhssgvdlgtenlyfqsnamqksvleqlkqvtmvvadtgdfelikkykpvdattn
    pslilkavkeqkysnlvaetiskvkannpdlnsddlvkeiaieilvsfgikildviegkv
    ssevdarvsfnsattidyakriiaryesngipkdrvlikiaatwegikaakllqkeginc
    nltlifdkaqakacaeagvylvspfvgritdwqmqqnnlktfpaiadddgvnsvkaiykl
    ykshgfktivmgasfrnveqvialagcdaltispvlleelknrdehlevkltknddvvtq
    spqiseadfrwlmnenamathklaegirlftkdtieleniikqnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e0cA (A:)
    mqksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskv
    kannpdlnsddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriia
    ryesngipkdrvlikiaatwegikaakllqkegincnltlifdkaqakacaeagvylvsp
    fvgritdwqmqqnnlktfpaiadddgvnsvkaiyklykshgfktivmgasfrnveqvial
    agcdaltispvlleelknrdehlevkltkpqiseadfrwlmnenamathklaegirlftk
    dtieleniikqnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e0cB (B:)
    mhhhhhhssgvdlgtenlyfqsnamqksvleqlkqvtmvvadtgdfelikkykpvdattn
    pslilkavkeqkysnlvaetiskvkannpdlnsddlvkeiaieilvsfgikildviegkv
    ssevdarvsfnsattidyakriiaryesngipkdrvlikiaatwegikaakllqkeginc
    nltlifdkaqakacaeagvylvspfvgritdwqmqqnnlktfpaiadddgvnsvkaiykl
    ykshgfktivmgasfrnveqvialagcdaltispvlleelknrdehlevkltknddvvtq
    spqiseadfrwlmnenamathklaegirlftkdtieleniikqnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e0cB (B:)
    qksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskvk
    annpdlnsddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriiar
    yesngipkdrvlikiaatwegikaakllqkegincnltlifdkaqakacaeagvylvspf
    vgritdwqmqqnnlktfpaiadddgvnsvkaiyklykshgfktivmgasfrnveqviala
    gcdaltispvlleelknrdehlevkltqiseadfrwlmnenamathklaegirlftkdti
    eleniikqnl