PDB entry 4dyx

View 4dyx on RCSB PDB site
Description: Crystal Structure of the Cu-adduct of Human H-Ferritin variant 4His-delta C-star
Class: oxidoreductase
Keywords: Four-helix bundle, oxidoreductase
Deposited on 2012-02-29, released 2013-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.171
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794 (0-171)
      • conflict (51)
      • conflict (58)
      • conflict (62)
      • engineered mutation (81)
      • engineered mutation (85)
      • engineered mutation (97)
      • engineered mutation (125)
    Domains in SCOPe 2.06: d4dyxa_
  • Heterogens: CU, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dyxA (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyfhhqsheehe
    hahklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklatdk
    ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg