PDB entry 4dyd

View 4dyd on RCSB PDB site
Description: Substrate-directed dual catalysis of dicarbonyl compounds by diketoreductase
Class: oxidoreductase
Keywords: oxidoreductase, nadh
Deposited on 2012-02-28, released 2012-11-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.217
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diketoreductase
    Species: Acinetobacter baylyi [TaxId:202950]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dyda1, d4dyda2
  • Heterogens: NAD, GOL, SO4, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dydA (A:)
    mtgitnvtvlgtgvlgsqiafqtafhgfavtaydintdaldaakkrfeglaavyekevag
    aadgaaqkalggirysddlaqavkdadlvieavpesldlkrdiytklgelapaktifatn
    sstllpsdlvgytgrgdkflalhfanhvwvnntaevmgttktdpevyqqvvefasaigmv
    pielkkekagyvlnsllvplldaaaellvdgiadpetidktwrigtgapkgpfeifdivg
    lttaynissvsgpkqrefaaylkenyidkgklglatgegfyry