PDB entry 4dy9

View 4dy9 on RCSB PDB site
Description: Leishmania major Peroxidase is a Cytochrome c Peroxidase
Class: electron transport
Keywords: Alpha Helical Bundle, Electron Transport, heme protein
Deposited on 2012-02-28, released 2012-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_16_1310, LMJF_16_1320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dy9a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dy9A (A:)
    mppkaraplppgdvergeklfkgraaqchtatkggsngvgpnlfgivnrpsgkvegftys
    kanaesgviwtpevldvylenpkkfmpgtkmsfagikkpqeradviayletlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dy9A (A:)
    raplppgdvergeklfkgraaqchtatkggsngvgpnlfgivnrpsgkvegftyskanae
    sgviwtpevldvylenpkkfmpgtkmsfagikkpqeradviayletlk