PDB entry 4dxy

View 4dxy on RCSB PDB site
Description: Crystal structures of CYP101D2 Y96A mutant
Class: oxidoreductase
Keywords: Cytochrome P450 mutant, haem-dependent, mono-oxygenases, OXIDOREDUCTASE
Deposited on 2012-02-28, released 2012-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Novosphingobium aromaticivorans [TaxId:279238]
    Gene: Saro_1478
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G8A2
      • engineered mutation (96)
    Domains in SCOPe 2.03: d4dxya_
  • Heterogens: HEM, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dxyA (A:)
    matnfdeavrakverpanvpedrvyeidmyalngiedgyheawkkvqhpgipdliwtpft
    gghwiatngdtvkevysdptrfsseviflpkeagekaqmvptkmdppehtpyrkaldkgl
    nlakirkvedkvrevasslidsfaargecdfaaeyaelfpvhvfmaladlpledipvlse
    yarqmtrpegntpeematdleagnngfyayvdpiirarvggdgddlitlmvnseingeri
    ahdkaqglisllllggldtvvnflsffmihlarhpelvaelrsdplklmrgaeemfrrfp
    vvsearmvakdqeykgvflkrgdmillptalhglddaanpepwkldfsrrsishstfggg
    phrcagmhlarmevivtleewlkripefsfkegetpiyhsgivaavenvplvwpiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dxyA (A:)
    rakverpanvpedrvyeidmyalngiedgyheawkkvqhpgipdliwtpftgghwiatng
    dtvkevysdptrfsseviflpkeagekaqmvptkmdppehtpyrkaldkglnlakirkve
    dkvrevasslidsfaargecdfaaeyaelfpvhvfmaladlpledipvlseyarqmtrpe
    gntpeematdleagnngfyayvdpiirarvggdgddlitlmvnseingeriahdkaqgli
    sllllggldtvvnflsffmihlarhpelvaelrsdplklmrgaeemfrrfpvvsearmva
    kdqeykgvflkrgdmillptalhglddaanpepwkldfsrrsishstfgggphrcagmhl
    armevivtleewlkripefsfkegetpiyhsgivaavenvplvwpi