PDB entry 4dxd

View 4dxd on RCSB PDB site
Description: Staphylococcal Aureus FtsZ in complex with 723
Class: cell cycle/inhibitor
Keywords: Rossmann Fold, GTPase, GTP binding, CELL CYCLE-INHIBITOR complex
Deposited on 2012-02-27, released 2012-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ftsZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dxda1, d4dxda2
  • Heterogens: GDP, 9PC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dxdA (A:)
    mhhhhhhlefeqgfnhlatlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlsk
    aeskiqigekltrglgaganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaa
    pvvakiakemgaltvgvvtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivd
    kstpmmeafkeadnvlrqgvqgisdliavsgevnldfadvktimsnqgsalmgigvssge
    nraveaakkaissplletsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmif
    gtvinpelqdeivvtviatgfddkptshgrksgstgfgtsvntssnatskdesftsnssn
    aqatdsvserthttkeddipsfirnreerrsrrtrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dxdA (A:)
    atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
    ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
    vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
    qgvqgisdliavsgevnldfadvktimsnqgsalmgigvssgenraveaakkaissplle
    tsivgaqgvlmnitggeslslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtvi
    atgfddk