PDB entry 4dwt

View 4dwt on RCSB PDB site
Description: Carbonmonoxy dehaloperoxidase-hemoglobin A structure at 2.05 Angstrom resolution
Class: oxidoreductase
Keywords: peroxidase, globin, hydrogen peroxide, 2,4,6-trihalophenol, OXIDOREDUCTASE
Deposited on 2012-02-26, released 2013-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwta_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwtb_
  • Heterogens: HEM, CMO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4dwtA (A:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4dwtB (B:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk