PDB entry 4dwr

View 4dwr on RCSB PDB site
Description: RNA ligase RtcB/Mn2+ complex
Class: ligase
Keywords: RNA ligase, RtcB, Mn2+, LIGASE
Deposited on 2012-02-26, released 2012-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-splicing ligase RtcB
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59245 (Start-96)
    • Uniprot O59245 (97-480)
      • expression tag (481-483)
    Domains in SCOPe 2.08: d4dwra1, d4dwra2
  • Chain 'B':
    Compound: tRNA-splicing ligase RtcB
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59245 (Start-96)
    • Uniprot O59245 (97-480)
      • expression tag (481-486)
    Domains in SCOPe 2.08: d4dwrb1, d4dwrb2
  • Chain 'C':
    Compound: tRNA-splicing ligase RtcB
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59245 (Start-96)
    • Uniprot O59245 (97-480)
      • expression tag (481-485)
    Domains in SCOPe 2.08: d4dwrc1, d4dwrc2
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dwrA (A:)
    mvvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykys
    ivmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlv
    dtlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadp
    eavsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrgl
    ghqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmit
    hwvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppg
    heavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyr
    gdrirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvak
    gaaaleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwrA (A:)
    vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
    vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
    tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe
    avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg
    hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith
    wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh
    eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg
    drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg
    aaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dwrB (B:)
    mvvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykys
    ivmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlv
    dtlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadp
    eavsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrgl
    ghqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmit
    hwvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppg
    heavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyr
    gdrirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvak
    gaaaleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwrB (B:)
    vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
    vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
    tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe
    avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg
    hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith
    wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh
    eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg
    drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg
    aaaleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dwrC (C:)
    mvvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykys
    ivmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlv
    dtlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadp
    eavsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrgl
    ghqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmit
    hwvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppg
    heavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyr
    gdrirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvak
    gaaaleh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwrC (C:)
    vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
    vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
    tlfknvpsgvriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpeavsq
    rakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglghqva
    sdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmithwvre
    sfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgheavp
    rlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrgdrir
    qellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakgaaal
    e