PDB entry 4dwo

View 4dwo on RCSB PDB site
Description: Crystal structure of a haloacid dehalogenase-like hydrolase (Target EFI-900331) from Bacteroides thetaiotaomicron with bound Mg crystal form II
Class: hydrolase
Keywords: HAD, putative phosphatase, Enzyme Function Initiative, EFI, Structural Genomics, HYDROLASE
Deposited on 2012-02-26, released 2012-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloacid dehalogenase-like hydrolase
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_3352
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dwoa_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dwoA (A:)
    mslkyklivldldgtltnskkeissrnretliriqeqgirlvlasgrptygivplanelr
    mnefggfilsynggeiinweskemmyenvlpnevvpvlyecartnhlsiltydgaeivte
    nsldpyvqkeaflnkmairetndfltditlpvakclivgdagklipveselcirlqgkin
    vfrsepyflelvpqgidkalslsvllenigmtreeviaigdgyndlsmikfagmgvamgn
    aqepvkkaadyitltndedgvaeaierifnveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwoA (A:)
    kyklivldldgtltnskkeissrnretliriqeqgirlvlasgrptygivplanelrmne
    fggfilsynggeiinweskemmyenvlpnevvpvlyecartnhlsiltydgaeivtensl
    dpyvqkeaflnkmairetndfltditlpvakclivgdagklipveselcirlqgkinvfr
    sepyflelvpqgidkalslsvllenigmtreeviaigdgyndlsmikfagmgvamgnaqe
    pvkkaadyitltndedgvaeaierifnv