PDB entry 4dwh

View 4dwh on RCSB PDB site
Description: Structure of the major type 1 pilus subunit FIMA bound to the FIMC (2.5 A resolution)
Class: structural protein/chaperone
Keywords: PROTEIN-CHAPERONE COMPLEX, IMMUNOGLOBIN-LIKE FOLD, INVOLVED IN TYPE 1 PILUS ASSEMBLY, STRUCTURAL PROTEIN-CHAPERONE complex
Deposited on 2012-02-24, released 2012-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: b4316, fimC, JW4279
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dwha1, d4dwha2
  • Chain 'B':
    Compound: Type-1 fimbrial protein, A chain
    Species: Escherichia coli [TaxId:562]
    Gene: b4314, fimA, JW4277, pilA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04128 (1-142)
      • expression tag (0)
  • Chain 'C':
    Compound: chaperone protein fimc
    Species: Escherichia coli [TaxId:562]
    Gene: b4316, fimC, JW4279
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dwhc1, d4dwhc2
  • Chain 'D':
    Compound: Type-1 fimbrial protein, A chain
    Species: Escherichia coli [TaxId:562]
    Gene: b4314, fimA, JW4277, pilA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04128 (1-142)
      • expression tag (0)
  • Heterogens: PEG, PG4, PO4, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dwhA (A:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwhA (A:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdentlqlaiisriklyyrpaklalppd
    qaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsgsnity
    rtindygaltpkmtgvm
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dwhC (C:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dwhC (C:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkentlqlaiisriklyyrpaklalpp
    dqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsdagsn
    ityrtindygaltpkmtgvme
    

  • Chain 'D':
    No sequence available.