PDB entry 4dwf

View 4dwf on RCSB PDB site
Description: Crystal structure of a HLA-B associated transcript 3 (BAT3) from Homo sapiens at 1.80 A resolution
Class: structural genomics, unknown function
Keywords: Ubiquitin-like domain, BAT3 protein, PF00240, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, UNKNOWN FUNCTION
Deposited on 2012-02-24, released 2012-03-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HLA-B-associated transcript 3
  Species: Homo sapiens [TaxId:9606]
  Gene: BAG6, BAT3, BC003133, G3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46379 (1-End)
    • leader sequence (0)
  Domains in SCOPe 2.02: d4dwfa_
• Chain 'B':
  Compound: HLA-B-associated transcript 3
  Species: Homo sapiens [TaxId:9606]
  Gene: BAG6, BAT3, BC003133, G3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46379 (1-End)
    • leader sequence (0)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4dwfA (A:)
  gepdslevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqddkk
  lqeynvggkvihlverappqthlpsgassg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4dwfA (A:)
  gepdslevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqddkk
  lqeynvggkvihlverapp
  

  
  
• Chain 'B':
  No sequence available.