PDB entry 4dw2

View 4dw2 on RCSB PDB site
Description: The crystal structure of uPA in complex with the Fab fragment of mAb-112
Class: hydrolase/immune system
Keywords: urokinase-type plasminogen activator, antibody, serine protease, zymogen, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2012-02-24, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: 0.243
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab fragment of pro-uPA antibody mAb-112
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4DW2 (0-211)
  • Chain 'L':
    Compound: Fab fragment of pro-uPA antibody mAb-112
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4DW2 (0-214)
    Domains in SCOPe 2.07: d4dw2l1, d4dw2l2
  • Chain 'U':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (Start-245)
      • engineered mutation (120)
      • engineered mutation (143)
    Domains in SCOPe 2.07: d4dw2u_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4dw2L (L:)
    dieltqspaimsaspgekvtmtcrasstvsfhylhwyqqksgaspklwiyatsnlasgvp
    arfsgsgsgtsysltissvetedaatyycqhysayprtfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dw2L (L:)
    dieltqspaimsaspgekvtmtcrasstvsfhylhwyqqksgaspklwiyatsnlasgvp
    arfsgsgsgtsysltissvetedaatyycqhysayprtfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceatktstspivksfnrnec
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4dw2U (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dw2U (U:)
    fttienqpwfaaiyrrvtyvcggslispcwvisathcfidypkkedyivylgrsrlnsnt
    qgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqtialpsmyndpq
    fgtsceitgfgkeqstdylypeqlkmtvvklishrecyygsevttkmlcaadpqwqgdsg
    gplvcslqgrmtltgivswgrkpgvytrvshflpwirshtk