SCOPe 2.08: Structural Classification of Proteins

PDB entry 4dvq

View 4dvq on RCSB PDB site
Description: Structure of human aldosterone synthase, CYP11B2, in complex with deoxycorticosterone
Class: oxidoreductase
Keywords: cytochrome P450, CYP11B2, Aldosterone synthase, monooxygenase, heme protein, mineralocorticoid, corticosteroid, mitochondria, membrane, OXIDOREDUCTASE
Deposited on 2012-02-23, released 2013-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.207
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4dvqa_
Chain 'B':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4dvqb_
Chain 'C':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4dvqc_
Chain 'D':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4dvqd_
Chain 'E':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-476)
  - expression tag (477-482)
Domains in SCOPe 2.08: d4dvqe1, d4dvqe2
Chain 'F':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-476)
  - expression tag (477-482)
Domains in SCOPe 2.08: d4dvqf1, d4dvqf2
Chain 'G':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4dvqg_
Chain 'H':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4dvqh_
Chain 'I':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4dvqi_
Chain 'J':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4dvqj_
Chain 'K':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099 (7-End)
Domains in SCOPe 2.08: d4dvqk_
Chain 'L':
Compound: Cytochrome P450 11B2, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: Aldosterone synthase, CYP11B2
Database cross-references and differences (RAF-indexed):
- Uniprot P19099
Domains in SCOPe 2.08: d4dvql_
Heterogens: HEM, 1CA, SO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4dvqA (A:)
makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
hhh