PDB entry 4dvq

View 4dvq on RCSB PDB site
Description: Structure of human aldosterone synthase, CYP11B2, in complex with deoxycorticosterone
Class: oxidoreductase
Keywords: cytochrome P450, CYP11B2, Aldosterone synthase, monooxygenase, heme protein, mineralocorticoid, corticosteroid, mitochondria, membrane, OXIDOREDUCTASE
Deposited on 2012-02-23, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.207
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dvqa_
  • Chain 'B':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dvqb_
  • Chain 'C':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dvqc_
  • Chain 'D':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dvqd_
  • Chain 'E':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19099 (7-476)
      • expression tag (477-482)
    Domains in SCOPe 2.07: d4dvqe1, d4dvqe2
  • Chain 'F':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19099 (7-476)
      • expression tag (477-482)
    Domains in SCOPe 2.07: d4dvqf1, d4dvqf2
  • Chain 'G':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dvqg_
  • Chain 'H':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dvqh_
  • Chain 'I':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dvqi_
  • Chain 'J':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dvqj_
  • Chain 'K':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dvqk_
  • Chain 'L':
    Compound: Cytochrome P450 11B2, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: Aldosterone synthase, CYP11B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dvql_
  • Heterogens: HEM, 1CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dvqA (A:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqA (A:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwldifhhvpfgfgmrqclgrrlaeae
    mllllhhvlkhflvetltqedikmvysfilrpgtsplltfrai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dvqB (B:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqB (B:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwldifhhvpfgfgmrqclgrrlaeae
    mllllhhvlkhflvetltqedikmvysfilrpgtsplltfrai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dvqC (C:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqC (C:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwldfhhvpfgfgmrqclgrrlaeaem
    llllhhvlkhflvetltqedikmvysfilrpgtsplltfrai
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dvqD (D:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqD (D:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwldfhhvpfgfgmrqclgrrlaeaem
    llllhhvlkhflvetltqedikmvysfilrpgtsplltfrai
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4dvqE (E:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqE (E:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwldnfhhvpfgfgmrqclgrrlaeae
    mllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhhhhh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4dvqF (F:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqF (F:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwldfhhvpfgfgmrqclgrrlaeaem
    llllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhhhhh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4dvqG (G:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqG (G:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwldfhhvpfgfgmrqclgrrlaeaem
    llllhhvlkhflvetltqedikmvysfilrpgtsplltfrai
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4dvqH (H:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqH (H:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwldfhhvpfgfgmrqclgrrlaeaem
    llllhhvlkhflvetltqedikmvysfilrpgtsplltfrai
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4dvqI (I:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqI (I:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwldfhhvpfgfgmrqclgrrlaeaem
    llllhhvlkhflvetltqedikmvysfilrpgtsplltfrai
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4dvqJ (J:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqJ (J:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwldfhhvpfgfgmrqclgrrlaeaem
    llllhhvlkhflvetltqedikmvysfilrpgtsplltfrai
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4dvqK (K:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqK (K:)
    tvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggprmvcvml
    pedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspka
    vqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvg
    hspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqk
    iyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarn
    pdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlq
    nyhipagtlvqvflyslgrnaalfprperynpqrwfhhvpfgfgmrqclgrrlaeaemll
    llhhvlkhflvetltqedikmvysfilrpgtsplltfrai
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4dvqL (L:)
    makktsstvlpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifrynlggp
    rmvcvmlpedveklqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnp
    dvlspkavqrflpmvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfg
    erlglvghspssaslnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqy
    gdnciqkiyqelafnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmt
    lfelarnpdvqqilrqeslaaaasisehpqkattelpllraalketlrlypvglflervv
    ssdlvlqnyhipagtlvqvflyslgrnaalfprperynpqrwldirgsgrnfhhvpfgfg
    mrqclgrrlaeaemllllhhvlkhflvetltqedikmvysfilrpgtsplltfrainhhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dvqL (L:)
    lpfeampqhpgnrwlrllqiwreqgyehlhlemhqtfqelgpifryprmvcvmlpedvek
    lqqvdslhpcrmilepwvayrqhrghkcgvfllngpewrfnrlrlnpdvlspkavqrflp
    mvdavardfsqalkkkvlqnargsltldvqpsifhytieasnlalfgerlglvghspssa
    slnflhalevmfkstvqlmfmprslsrwispkvwkehfeawdcifqygdnciqkiyqela
    fnrpqhytgivaelllkaelsleaikansmeltagsvdttafpllmtlfelarnpdvqqi
    lrqeslaaaasisehpqkattelpllraalketlrlypvglflervvssdlvlqnyhipa
    gtlvqvflyslgrnaalfprperynpqrwldhvpfgfgmrqclgrrlaeaemllllhhvl
    khflvetltqedikmvysfilrpgtsplltfrai