PDB entry 4dvc

View 4dvc on RCSB PDB site
Description: Structural and functional studies of TcpG, the Vibrio cholerae DsbA disulfide-forming protein required for pilus and cholera toxin production
Class: oxidoreductase
Keywords: Cholera, pilus assembly, oxidoreductase, Thioredoxin fold, DsbA-like, Disulfide bond, DsbB
Deposited on 2012-02-23, released 2012-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.12
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbA
    Species: Vibrio cholerae [TaxId:243277]
    Gene: tpcG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32557 (2-183)
      • expression tag (0-1)
      • see remark 999 (25)
      • engineered mutation (136)
      • engineered mutation (166)
    Domains in SCOPe 2.06: d4dvca1, d4dvca2
  • Heterogens: DMS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dvcA (A:)
    snaaqfkegehyqvlktpassspvvseffsfycphcntfepiiaqlkqqlpegakfqknh
    vsfmggnmgqamskayatmialevedkmvpvmfnrihtlrkppkdeqelrqifldegida
    akfdaayngfavdsmvhrfdkqfqdsgltgvpavvvnnrylvqgqsaksldeyfdlvnyl
    ltlk