PDB entry 4dut

View 4dut on RCSB PDB site
Description: The structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis
Class: transferase
Keywords: SSGCID, Seattle Structural Genomics Center for Infectious Disease, NIAID, National Institute of Allergy and Infectious Diseases, TRANSFERASE
Deposited on 2012-02-22, released 2012-03-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: ndk, BTH_I2231
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4duta_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: ndk, BTH_I2231
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4dutb_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dutA (A:)
    gpgsmalertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhae
    rpffkdlvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanav
    hgsdapetarveiafffpemnvysr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dutA (A:)
    alertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhaerpffk
    dlvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgsda
    petarveiafffpemnvysr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dutB (B:)
    gpgsmalertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhae
    rpffkdlvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanav
    hgsdapetarveiafffpemnvysr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dutB (B:)
    lertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyakdlvefmisg
    pvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgsdapetarveia
    fffpemnvysr