PDB entry 4duq

View 4duq on RCSB PDB site
Description: The Structure of Ca2+-loaded S100A2 at 1.3A resolution
Class: metal binding protein
Keywords: EF-hand, Calcium-binding, Zinc-binding, tumor supressor, METAL BINDING PROTEIN
Deposited on 2012-02-22, released 2012-03-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.138
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A2, S100L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29034
      • engineered mutation (2)
      • engineered mutation (21)
      • engineered mutation (86)
    Domains in SCOPe 2.02: d4duqa_
  • Chain 'B':
    Compound: Protein S100-A2
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A2, S100L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29034
      • engineered mutation (2)
      • engineered mutation (21)
      • engineered mutation (86)
    Domains in SCOPe 2.02: d4duqb_
  • Heterogens: CA, 15P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4duqA (A:)
    mmsssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklm
    gsldensdqqvdfqeyavflalitvmsndffqgcpdrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4duqA (A:)
    sssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklmgs
    ldensdqqvdfqeyavflalitvmsndf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4duqB (B:)
    mmsssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklm
    gsldensdqqvdfqeyavflalitvmsndffqgcpdrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4duqB (B:)
    sssleqalavlvttfhkyssqegdkfklskgemkellhkelpsfvgekvdeeglkklmgs
    ldensdqqvdfqeyavflalitvmsndffq