PDB entry 4dtk

View 4dtk on RCSB PDB site
Description: Novel and selective pan-PIM kinase inhibitor
Class: transferase/transferase inhibitor
Keywords: PIM1, Kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-02-21, released 2012-07-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.166
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dtka_
  • Heterogens: EDO, 7LI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dtkA (A:)
    ekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpme
    vvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffw
    qvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysp
    pewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirw
    clalrpsdrptfeeiqnhpwmqdvllpqetaeihlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dtkA (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh