PDB entry 4ds7

View 4ds7 on RCSB PDB site
Description: Crystal structure of yeast calmodulin bound to the C-terminal fragment of spindle pole body protein Spc110
Class: protein binding
Keywords: protein binding, metal binding, spindle pole body, structural protein
Deposited on 2012-02-18, released 2012-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Kluyveromyces lactis [TaxId:284590]
    Gene: CMD1, KLLA0B09427g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ds7a_
  • Chain 'B':
    Compound: calmodulin
    Species: Kluyveromyces lactis [TaxId:284590]
    Gene: CMD1, KLLA0B09427g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ds7b_
  • Chain 'C':
    Compound: calmodulin
    Species: Kluyveromyces lactis [TaxId:284590]
    Gene: CMD1, KLLA0B09427g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ds7c_
  • Chain 'D':
    Compound: calmodulin
    Species: Kluyveromyces lactis [TaxId:284590]
    Gene: CMD1, KLLA0B09427g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ds7d_
  • Chain 'E':
    Compound: Spindle pole body component 110
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: SPC110, NUF1, XCM1, YDR356W, D9476.3
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Spindle pole body component 110
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: SPC110, NUF1, XCM1, YDR356W, D9476.3
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Spindle pole body component 110
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: SPC110, NUF1, XCM1, YDR356W, D9476.3
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Spindle pole body component 110
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: SPC110, NUF1, XCM1, YDR356W, D9476.3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SR, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ds7A (A:)
    msqnlteeqiaefkeafalfdkdnsgsisaselatvmrslglspseaevadlmneidvdg
    nhaiefseflalmsrqlkcndseqelleafkvfdkngdglisaaelkhvltsigekltda
    evdemlrevsdgsgeinikqfaallsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ds7A (A:)
    nlteeqiaefkeafalfdkdnsgsisaselatvmrslglspseaevadlmneidvdgnha
    iefseflalmsrqlkcndseqelleafkvfdkngdglisaaelkhvltsigekltdaevd
    emlrevsdgsgeinikqfaallsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ds7B (B:)
    msqnlteeqiaefkeafalfdkdnsgsisaselatvmrslglspseaevadlmneidvdg
    nhaiefseflalmsrqlkcndseqelleafkvfdkngdglisaaelkhvltsigekltda
    evdemlrevsdgsgeinikqfaallsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ds7B (B:)
    lteeqiaefkeafalfdkdnsgsisaselatvmrslglspseaevadlmneidvdgnhai
    efseflalmsrqlkcndseqelleafkvfdkngdglisaaelkhvltsigekltdaevde
    mlrevsdgsgeinikqfaalls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ds7C (C:)
    msqnlteeqiaefkeafalfdkdnsgsisaselatvmrslglspseaevadlmneidvdg
    nhaiefseflalmsrqlkcndseqelleafkvfdkngdglisaaelkhvltsigekltda
    evdemlrevsdgsgeinikqfaallsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ds7C (C:)
    lteeqiaefkeafalfdkdnsgsisaselatvmrslglspseaevadlmneidvdgnhai
    efseflalmsrqlkcndseqelleafkvfdkngdglisaaelkhvltsigekltdaevde
    mlrevsdgsgeinikqfaallsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ds7D (D:)
    msqnlteeqiaefkeafalfdkdnsgsisaselatvmrslglspseaevadlmneidvdg
    nhaiefseflalmsrqlkcndseqelleafkvfdkngdglisaaelkhvltsigekltda
    evdemlrevsdgsgeinikqfaallsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ds7D (D:)
    lteeqiaefkeafalfdkdnsgsisaselatvmrslglspseaevadlmneidvdgnhai
    efseflalmsrqlkcndseqelleafkvfdkngdglisaaelkhvltsigekltdaevde
    mlrevsdgsgeinikqfaallsk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.