PDB entry 4ds2

View 4ds2 on RCSB PDB site
Description: Ubiquitin conjugating enzyme (putative) from Trypanosoma cruzi
Class: ligase
Keywords: Structural Genomics, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, UBCc superfamily, LIGASE
Deposited on 2012-02-17, released 2012-02-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.231
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2, putative
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: Tc00.1047053506635.90, TcCLB.506635.90
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ds2a_
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2, putative
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: Tc00.1047053506635.90, TcCLB.506635.90
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ds2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ds2A (A:)
    gpgsmknisnkriikdlkllleevdanneanssgsphstaifsvdtdtiynwilkvkapa
    dsvyggagntyqlsvlfsddyphepptvrfvtpvysplvtgeggicdrmvndfwtpdqha
    sdviklvldrvfsqyksrrdddvnpearhylekfpqdfaarvrrgrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ds2A (A:)
    mknisnkriikdlkllleevdanneasphstaifsvdtdtiynwilkvkapadsvyggag
    ntyqlsvlfsddyphepptvrfvtpvysplvtgeggicdrmvndfwtpdqhasdviklvl
    drvfsqyksrrdddvnpearhylekfpqdfaarvrrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ds2B (B:)
    gpgsmknisnkriikdlkllleevdanneanssgsphstaifsvdtdtiynwilkvkapa
    dsvyggagntyqlsvlfsddyphepptvrfvtpvysplvtgeggicdrmvndfwtpdqha
    sdviklvldrvfsqyksrrdddvnpearhylekfpqdfaarvrrgrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ds2B (B:)
    mknisnkriikdlkllleevdanneasphstaifsvdtdtiynwilkvkapadsvyggag
    ntyqlsvlfsddyphepptvrfvtpvysplvtgeggicdrmvndfwtpdqhasdviklvl
    drvfsqyksrrdddvnpearhylekfpqdfaarvrr