PDB entry 4drq

View 4drq on RCSB PDB site
Description: Exploration of Pipecolate Sulfonamides as Binders of the FK506-Binding Proteins 51 and 52: Complex of FKBP51 with 2-(3-((R)-1-((S)-1-(3,5-dichlorophenylsulfonyl)piperidine-2-carbonyloxy)-3-(3,4-dimethoxy -phenyl)propyl)phenoxy)acetic acid
Class: isomerase
Keywords: Fk-506 binding domain, Hsp90 cochaperone, immunophilin, peptidyl-prolyl isomerase, ISOMERASE
Deposited on 2012-02-17, released 2012-04-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.138
AEROSPACI score: 1.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP5
    Species: Homo sapiens [TaxId:9606]
    Gene: AIG6, FKBP5, FKBP51
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13451 (3-127)
      • expression tag (0-2)
      • conflict (6)
    Domains in SCOPe 2.03: d4drqa_
  • Heterogens: 0OS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4drqA (A:)
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkge