PDB entry 4drn

View 4drn on RCSB PDB site
Description: EVALUATION OF SYNTHETIC FK506 ANALOGS AS LIGANDS FOR FKBP51 AND FKBP52: COMPLEX OF FKBP51 WITH {3-[(1R)-3-(3,4-dimethoxyphenyl)-1-({[(2S)-1-{[(1S,2R)-2-ethyl-1-hydroxycyclohexyl](oxo)acetyl}piperidin-2-yl]carbonyl}oxy)propyl]phenoxy}acetic acid
Class: isomerase
Keywords: Fk-506 binding domain, Hsp90 cochaperone, immunophilin, peptidyl-prolyl isomerase, ISOMERASE
Deposited on 2012-02-17, released 2012-05-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.156
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP5
    Species: Homo sapiens [TaxId:9606]
    Gene: AIG6, FKBP5, FKBP51
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13451 (3-127)
      • expression tag (0-2)
      • conflict (6)
    Domains in SCOPe 2.03: d4drna_
  • Heterogens: 0MC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4drnA (A:)
    gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
    rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
    elldfkge