PDB entry 4dqh

View 4dqh on RCSB PDB site
Description: Crystal Structure of (R14C/E65C) HIV-1 Protease in complex with DRV
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, Protease inhibitors, AIDS, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-02-15, released 2012-03-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Wild-type HIV-1 protease dimer
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • PDB 4DQH (0-98)
    Domains in SCOPe 2.04: d4dqha_
  • Chain 'B':
    Compound: Wild-type HIV-1 protease dimer
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • PDB 4DQH (0-98)
    Domains in SCOPe 2.04: d4dqhb_
  • Heterogens: 017, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dqhA (A:)
    pqitlwkrplvticiggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qiiiciaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dqhB (B:)
    pqitlwkrplvticiggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qiiiciaghkaigtvlvgptpvniigrnlltqigatlnf