PDB entry 4dqh

View 4dqh on RCSB PDB site
Description: Crystal Structure of (R14C/E65C) HIV-1 Protease in complex with DRV
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, Protease inhibitors, AIDS, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-02-15, released 2012-03-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Wild-type HIV-1 protease dimer
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • PDB 4DQH (0-98)
  Domains in SCOPe 2.03: d4dqha_
• Chain 'B':
  Compound: Wild-type HIV-1 protease dimer
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • PDB 4DQH (0-98)
  Domains in SCOPe 2.03: d4dqhb_
• Heterogens: 017, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4dqhA (A:)
  pqitlwkrplvticiggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
  qiiiciaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4dqhB (B:)
  pqitlwkrplvticiggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
  qiiiciaghkaigtvlvgptpvniigrnlltqigatlnf