PDB entry 4dqc
View 4dqc on RCSB PDB site
Description: Crystal Structure of (G16C/L38C) HIV-1 Protease in Complex with DRV
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, Protease inhibitors, AIDS, Aspartyl protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2012-02-15, released
2012-03-07
The last revision prior to the SCOPe 2.05 freeze date was dated
2012-05-02, with a file datestamp of
2012-04-27.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.184
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Aspartyl protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4dqca_ - Chain 'B':
Compound: Aspartyl protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4dqcb_ - Heterogens: 017, GOL, PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4dqcA (A:)
pqitlwkrplvtiricgqlkealldtgaddtvieemncpgkwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4dqcB (B:)
pqitlwkrplvtiricgqlkealldtgaddtvieemncpgkwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf