PDB entry 4dqb

View 4dqb on RCSB PDB site
Description: Crystal Structure of wild-type HIV-1 Protease in Complex with DRV
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, Protease inhibitors, AIDS, Aspartyl protease, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-02-15, released 2012-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartyl protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • PDB 4DQB (0-98)
    Domains in SCOPe 2.08: d4dqba_
  • Chain 'B':
    Compound: Aspartyl protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • PDB 4DQB (0-98)
    Domains in SCOPe 2.08: d4dqbb_
  • Heterogens: EDO, 017, PO4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dqbA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dqbB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf