PDB entry 4dq6

View 4dq6 on RCSB PDB site
Description: Crystal structure of PLP-bound putative aminotransferase from Clostridium difficile 630
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, internal aldimine with pyridoxalphosphate, TRANSFERASE
Deposited on 2012-02-15, released 2012-02-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.154
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative pyridoxal phosphate-dependent transferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD2733, CD630_27330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dq6a_
  • Chain 'B':
    Compound: Putative pyridoxal phosphate-dependent transferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD2733, CD630_27330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dq6b_
  • Heterogens: PLP, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dq6A (A:)
    snamnynfneivdrsnnfsskwsemekkygtndllpmwvadmdfkaapciidslknrleq
    eiygyttrpdsynesivnwlyrrhnwkiksewliyspgvipaisllineltkandkimiq
    epvyspfnsvvknnnreliisplqklengnyimdyedienkikdvklfilcnphnpvgrv
    wtkdelkklgdiclkhnvkiisdeihsdiilkkhkhipmasiskefekntitcmaptktf
    niaglqssyvvlpdekdykllddaftridikrnncfslvateasynngeswlesfleyle
    snidfaikyinenmpklkvrkpegtyllwvdfsalglsdeelesilvqkgkvalnqgnsf
    giggsgyqrinlacprsmleealiriknain
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dq6A (A:)
    mnynfneivdrsnnfsskwsemekkygtndllpmwvadmdfkaapciidslknrleqeiy
    gyttrpdsynesivnwlyrrhnwkiksewliyspgvipaisllineltkandkimiqepv
    yspfnsvvknnnreliisplqklengnyimdyedienkikdvklfilcnphnpvgrvwtk
    delkklgdiclkhnvkiisdeihsdiilkkhkhipmasiskefekntitcmaptktfnia
    glqssyvvlpdekdykllddaftridikrnncfslvateasynngeswlesfleylesni
    dfaikyinenmpklkvrkpegtyllwvdfsalglsdeelesilvqkgkvalnqgnsfgig
    gsgyqrinlacprsmleealiriknain
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dq6B (B:)
    snamnynfneivdrsnnfsskwsemekkygtndllpmwvadmdfkaapciidslknrleq
    eiygyttrpdsynesivnwlyrrhnwkiksewliyspgvipaisllineltkandkimiq
    epvyspfnsvvknnnreliisplqklengnyimdyedienkikdvklfilcnphnpvgrv
    wtkdelkklgdiclkhnvkiisdeihsdiilkkhkhipmasiskefekntitcmaptktf
    niaglqssyvvlpdekdykllddaftridikrnncfslvateasynngeswlesfleyle
    snidfaikyinenmpklkvrkpegtyllwvdfsalglsdeelesilvqkgkvalnqgnsf
    giggsgyqrinlacprsmleealiriknain
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dq6B (B:)
    mnynfneivdrsnnfsskwsemekkygtndllpmwvadmdfkaapciidslknrleqeiy
    gyttrpdsynesivnwlyrrhnwkiksewliyspgvipaisllineltkandkimiqepv
    yspfnsvvknnnreliisplqklengnyimdyedienkikdvklfilcnphnpvgrvwtk
    delkklgdiclkhnvkiisdeihsdiilkkhkhipmasiskefekntitcmaptktfnia
    glqssyvvlpdekdykllddaftridikrnncfslvateasynngeswlesfleylesni
    dfaikyinenmpklkvrkpegtyllwvdfsalglsdeelesilvqkgkvalnqgnsfgig
    gsgyqrinlacprsmleealiriknain