PDB entry 4dpa

View 4dpa on RCSB PDB site
Description: The 1.05 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 6.0
Class: electron transport
Keywords: membrane, thylakoid, transit peptide, plastocyanin-like domain, copper-binding, ELECTRON TRANSPORT
Deposited on 2012-02-13, released 2013-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Plastocyanin A, chloroplastic
    Species: Populus nigra [TaxId:3691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dpax_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dpaX (X:)
    idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
    dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn