PDB entry 4doe

View 4doe on RCSB PDB site
Description: The liganded structure of Cbescii CelA GH9 module
Class: hydrolase
Keywords: CelA, GH9, cellulase, (a/a)6 barrel, Glycoside hydrolase, Cellobiose, Cellotriose, HYDROLASE
Deposited on 2012-02-09, released 2013-02-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.149
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-beta-glucanase
    Species: Caldicellulosiruptor bescii [TaxId:31899]
    Gene: CELA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96311 (23-474)
      • expression tag (21-22)
      • conflict (175)
      • conflict (312)
    Domains in SCOPe 2.04: d4doea_
  • Heterogens: DIO, CA, CBK, CT3, GOL, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4doeA (A:)
    mgsshhhhhhssglvprgshmasgsfnygealqkaimfyefqmsgklpnwvrnnwrgdsa
    lkdgqdngldltggwfdagdhvkfnlpmsytgtmlswavyeykdafvksgqlehilnqie
    wvndyfvkchpskyvyyyqvgdgskdhawwgpaevmqmerpsfkvtqsspgstvvaetaa
    slaaasivlkdrnptkaatylqhakelyefaevtksdagytaangyynswsgfydelswa
    avwlylatndstyltkaesyvqnwpkisgsntidykwahcwddvhngaalllakitgkdi
    ykqiieshldywttgyngerikytpkglawldqwgslryatttaflafvysdwvgcpstk
    keiyrkfgesqidyalgsagrsfvvgfgtnppkrphhrtahsswadsqsipsyhrhtlyg
    alvggpgsddsytddisnyvnnevacdynagfvgalakmyqlyggnpipdfkaie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4doeA (A:)
    asgsfnygealqkaimfyefqmsgklpnwvrnnwrgdsalkdgqdngldltggwfdagdh
    vkfnlpmsytgtmlswavyeykdafvksgqlehilnqiewvndyfvkchpskyvyyyqvg
    dgskdhawwgpaevmqmerpsfkvtqsspgstvvaetaaslaaasivlkdrnptkaatyl
    qhakelyefaevtksdagytaangyynswsgfydelswaavwlylatndstyltkaesyv
    qnwpkisgsntidykwahcwddvhngaalllakitgkdiykqiieshldywttgyngeri
    kytpkglawldqwgslryatttaflafvysdwvgcpstkkeiyrkfgesqidyalgsagr
    sfvvgfgtnppkrphhrtahsswadsqsipsyhrhtlygalvggpgsddsytddisnyvn
    nevacdynagfvgalakmyqlyggnpipdfkaie