PDB entry 4do6

View 4do6 on RCSB PDB site
Description: Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
Class: hydrolase
Keywords: beta/alpha)8 barrel, glycosidase, carbohydrate-binding protein, glycoprotein, lysosome, hydrolase
Deposited on 2012-02-09, released 2012-10-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.154
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-N-acetylgalactosaminidase
    Species: Homo sapiens [TaxId:9606]
    Gene: nagA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17050 (0-End)
      • engineered mutation (183)
    Domains in SCOPe 2.03: d4do6a1, d4do6a2
  • Chain 'B':
    Compound: alpha-N-acetylgalactosaminidase
    Species: Homo sapiens [TaxId:9606]
    Gene: nagA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17050 (0-393)
      • engineered mutation (183)
      • expression tag (394-399)
    Domains in SCOPe 2.03: d4do6b1, d4do6b2
  • Heterogens: NAG, CIT, GLC, 2PE, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4do6A (A:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypiknlemsqqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4do6A (A:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypikn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4do6B (B:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypiknlemsqqhhhhhh