PDB entry 4do5

View 4do5 on RCSB PDB site
Description: Pharmacological chaperones for human alpha-N-acetylgalactosaminidase
Class: hydrolase/hydrolase inhibitor
Keywords: PHARMACOLOGICAL CHAPERONE, BETA/ALPHA)8 BARREL, GLYCOSIDASE, CARBOHYDRATE-BINDING PROTEIN, GLYCOPROTEIN, LYSOSOME, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-02-09, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.16
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-N-acetylgalactosaminidase
    Species: Homo sapiens [TaxId:9606]
    Gene: nagA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17050 (0-End)
      • engineered mutation (183)
    Domains in SCOPe 2.06: d4do5a1, d4do5a2
  • Chain 'B':
    Compound: alpha-N-acetylgalactosaminidase
    Species: Homo sapiens [TaxId:9606]
    Gene: nagA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17050 (0-393)
      • engineered mutation (183)
      • expression tag (394-399)
    Domains in SCOPe 2.06: d4do5b1, d4do5b2, d4do5b3
  • Heterogens: NAG, DGJ, CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4do5A (A:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypiknlemsqqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4do5A (A:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4do5B (B:)
    ldngllqtppmgwlawerfrcnincdedpknciseqlfmemadrmaqdgwrdmgytylni
    ddcwiggrdasgrlmpdpkrfphgipfladyvhslglklgiyadmgnftcmgypgttldk
    vvqdaqtfaewkvdmlkldgcfstpeeraqgypkmaaalnatgrpiafscswpayegglp
    prvqyslladicnlwrnyddiqdswwsvlsilnwfvehqdilqpvagpghwndpdmllig
    nfglsleqsraqmalwtvlaapllmstdlrtisaqnmdilqnplmikinqdplgiqgrri
    hkekslievymrplsnkasalvffscrtdmpyryhsslgqlnftgsviyeaqdvysgdii
    sglrdetnftviinpsgvvmwylypiknlemsqqhhhhhh