PDB entry 4do1

View 4do1 on RCSB PDB site
Description: The crystal structures of 4-methoxybenzoate bound CYP199A4
Class: oxidoreductase
Keywords: Cytochrome P450, Secondary metabolites biosynthesis, transport, catabolism, OXIDOREDUCTASE
Deposited on 2012-02-09, released 2012-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4do1a_
  • Chain 'B':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4do1b_
  • Chain 'C':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4do1c_
  • Chain 'D':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4do1d_
  • Heterogens: HEM, ANN, SO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4do1A (A:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4do1A (A:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4do1B (B:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4do1B (B:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4do1C (C:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4do1C (C:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4do1D (D:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4do1D (D:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa