PDB entry 4dnz

View 4dnz on RCSB PDB site
Description: The crystal structures of CYP199A4
Class: oxidoreductase
Keywords: Cytochrome P450, Secondary metabolites, biosynthesis, transport, catabolism, OXIDOREDUCTASE
Deposited on 2012-02-09, released 2012-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.201
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4dnza_
  • Chain 'B':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4dnzb_
  • Chain 'C':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4dnzc_
  • Chain 'D':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4dnzd_
  • Heterogens: HEM, SO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dnzA (A:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnzA (A:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dnzB (B:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnzB (B:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dnzC (C:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnzC (C:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dnzD (D:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dnzD (D:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa