PDB entry 4dne

View 4dne on RCSB PDB site
Description: Crystal structure of a triple-mutant of streptavidin in complex with desthiobiotin
Class: biotin-binding protein
Keywords: biotin, BIOTIN-BINDING PROTEIN
Deposited on 2012-02-08, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (67-68)
      • engineered mutation (70)
    Domains in SCOPe 2.07: d4dnea_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (67-68)
      • engineered mutation (70)
    Domains in SCOPe 2.07: d4dneb_
  • Heterogens: DTB, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dneA (A:)
    mrkivvaaiavslttvsitasasadpskdskaqvsaaeagitgtwynqlgstfivtagad
    galtgtyvtargnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqy
    vggaearintqwlltsgtteanawkstlvghdtftkvkpsaasidaakkagvnngnplda
    vqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dneA (A:)
    eagitgtwynqlgstfivtagadgaltgtyvtargnaesryvltgrydsapatdgsgtal
    gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dneB (B:)
    mrkivvaaiavslttvsitasasadpskdskaqvsaaeagitgtwynqlgstfivtagad
    galtgtyvtargnaesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqy
    vggaearintqwlltsgtteanawkstlvghdtftkvkpsaasidaakkagvnngnplda
    vqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dneB (B:)
    gitgtwynqlgstfivtagadgaltgtyvtargnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp