PDB entry 4dmn

View 4dmn on RCSB PDB site
Description: HIV-1 Integrase Catalytical Core Domain
Class: VIRAL PROTEIN/Inhibitor
Keywords: Integrase, CCD, DDE motif, dimer interface, VIRAL PROTEIN-Inhibitor complex
Deposited on 2012-02-08, released 2012-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 integrase
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • conflict (135)
    Domains in SCOPe 2.08: d4dmna_
  • Heterogens: ARS, SO4, 0L9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dmnA (A:)
    mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp
    vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa
    ehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dmnA (A:)
    dcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvh
    tdngsnftsttvkaacwwagikqefgiesmnkelkkiigqvrdqaehlktavqmavfihn
    kkrkggiggysagerivdiiatdiq