PDB entry 4dm6

View 4dm6 on RCSB PDB site
Description: Crystal structure of RARb LBD homodimer in complex with TTNPB
Class: TRANSCRIPTION/protein binding
Keywords: TRANSCRIPTION, NUCLEAR RECEPTOR, RETINOIC ACID, ALPHA HELICAL SANDWICH, TRANSCRIPTION REGULATOR, RETINOIC ACID BINDING, NUCLEUS - CYTOPLASM, TRANSCRIPTION-protein binding complex
Deposited on 2012-02-07, released 2012-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: RARB, HAP, NR1B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dm6a1, d4dm6a2
  • Chain 'B':
    Compound: Retinoic acid receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: RARB, HAP, NR1B2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dm6b_
  • Chain 'E':
    Compound: Nuclear receptor coactivator 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Nuclear receptor coactivator 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dm6A (A:)
    mgsshhhhhhssglvprgshmesyemtaelddltekirkahqetfpslcqlgkyttnssa
    dhrvrldlglwdkfselatkciikivefakrlpgftgltiadqitllkaacldililric
    trytpeqdtmtfsdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsaicl
    icgdrqdleeptkvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakgaer
    vitlkmeipgsmppliqemlenseghe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dm6A (A:)
    esyemtaelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkc
    iikivefakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrt
    qmhnagfgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepl
    lealkiyirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dm6B (B:)
    mgsshhhhhhssglvprgshmesyemtaelddltekirkahqetfpslcqlgkyttnssa
    dhrvrldlglwdkfselatkciikivefakrlpgftgltiadqitllkaacldililric
    trytpeqdtmtfsdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsaicl
    icgdrqdleeptkvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakgaer
    vitlkmeipgsmppliqemlenseghe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dm6B (B:)
    yemtaelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkcii
    kivefakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqm
    hnagfgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqeplle
    alkiyirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlen
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.