PDB entry 4dlp

View 4dlp on RCSB PDB site
Description: Crystal structure of methionyl-tRNA synthetase MetRS from Brucella melitensis bound to selenomethionine
Class: ligase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, class Ia aminoacyl-tRNA synthetase, selenomethionine, anomalous signal, protein synthesis, ATP-dependent, Ligase
Deposited on 2012-02-06, released 2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoacyl-tRNA synthetase, class I:Aminoacyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, class Ia
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: BAB1_1014, metG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dlpa1, d4dlpa2
  • Chain 'B':
    Compound: Aminoacyl-tRNA synthetase, class I:Aminoacyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, class Ia
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: BAB1_1014, metG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dlpb1, d4dlpb2
  • Chain 'C':
    Compound: Aminoacyl-tRNA synthetase, class I:Aminoacyl-tRNA synthetase, class Ia:Methionyl-tRNA synthetase, class Ia
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: BAB1_1014, metG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4dlpc1, d4dlpc2
  • Heterogens: MSE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dlpA (A:)
    mahhhhhhmgtleaqtqgpgsmsrekyyittaiaypngkphighayeliatdamarfqrl
    ngmdvyfltgtdehgikmlqsarkegitprdladrntsafrrmaevlnssnddyirtsee
    rhykasqaiwqamvangdiykggyagwysvrdeayygeeetevradgvrygpqgtpvewv
    eeesyffrlsayqdklldlyennpgfimpaerrneivsfvksglkdlsisrttfdwgipv
    pgdekhvmyvwvdaltnyitalgypdttderwaywpanahiigkdisrfhavywpaflms
    aqlplpkrvfahgflfnrgekmsksvgnvidpfelverygldqlryflmrevpfgqdgsy
    sheaivnrtnadlandlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaleta
    rkamddqalhlalgaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgim
    vqpfipqsaeklldilavpadkrqfadvlasplaggtdlpapqpvfpryveadeqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dlpA (A:)
    rekyyittaiaypngkphighayeliatdamarfqrlngmdvyfltgtdehgikmlqsar
    kegitprdladrntsafrrmaevlnssnddyirtseerhykasqaiwqamvangdiykgg
    yagwysvrdeayygeeetevradgvrygpqgtpvewveeesyffrlsayqdklldlyenn
    pgfimpaerrneivsfvksglkdlsisrtdwgipvpgdekhvmyvwvdaltnyitalgyp
    dttderwaywpanahiigkdisrfhavywpaflmsaqlplpkrvfahgflfnidpfelve
    rygldqlryflmrevpfgqdgsysheaivnrtnadlandlgnlaqrslsmiakncegkvp
    qpgafseadkaildqadaaletarkamddqalhlalgaifavvaeanryfagqepwalrk
    tdparmgtvlyvtaevlrrvgimvqpfipqsaeklldilavpadkrqfadvlasplaggt
    dlpapqpvfpryv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dlpB (B:)
    mahhhhhhmgtleaqtqgpgsmsrekyyittaiaypngkphighayeliatdamarfqrl
    ngmdvyfltgtdehgikmlqsarkegitprdladrntsafrrmaevlnssnddyirtsee
    rhykasqaiwqamvangdiykggyagwysvrdeayygeeetevradgvrygpqgtpvewv
    eeesyffrlsayqdklldlyennpgfimpaerrneivsfvksglkdlsisrttfdwgipv
    pgdekhvmyvwvdaltnyitalgypdttderwaywpanahiigkdisrfhavywpaflms
    aqlplpkrvfahgflfnrgekmsksvgnvidpfelverygldqlryflmrevpfgqdgsy
    sheaivnrtnadlandlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaleta
    rkamddqalhlalgaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgim
    vqpfipqsaeklldilavpadkrqfadvlasplaggtdlpapqpvfpryveadeqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dlpB (B:)
    srekyyittaiaypngkphighayeliatdamarfqrlngmdvyfltgtdehgikmlqsa
    rkegitprdladrntsafrrmaevlnssnddyirtseerhykasqaiwqamvangdiykg
    gyagwwveeesyffrlsayqdklldlyennpgfimpaerrneivsfvksglkdlsisrtt
    fdwgipvpgdekhvmyvwvdaltnyitalgypdttderwaywpanahiigkdisrfhavy
    wpaflmsaqlplpkrvfahgflfnidpfelverygldqlryflmrevpfgqdgsysheai
    vnrtnadlandlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaletarkamd
    dqalhlalgaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgimvqpfi
    pqsaeklldilavpadkrqfadvlasplaggtdlpapqpvfpry
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dlpC (C:)
    mahhhhhhmgtleaqtqgpgsmsrekyyittaiaypngkphighayeliatdamarfqrl
    ngmdvyfltgtdehgikmlqsarkegitprdladrntsafrrmaevlnssnddyirtsee
    rhykasqaiwqamvangdiykggyagwysvrdeayygeeetevradgvrygpqgtpvewv
    eeesyffrlsayqdklldlyennpgfimpaerrneivsfvksglkdlsisrttfdwgipv
    pgdekhvmyvwvdaltnyitalgypdttderwaywpanahiigkdisrfhavywpaflms
    aqlplpkrvfahgflfnrgekmsksvgnvidpfelverygldqlryflmrevpfgqdgsy
    sheaivnrtnadlandlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaleta
    rkamddqalhlalgaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgim
    vqpfipqsaeklldilavpadkrqfadvlasplaggtdlpapqpvfpryveadeqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dlpC (C:)
    rekyyittaiaypngkphighayeliatdamarfqrlngmdvyfltgtdehgikmlqsar
    kegitprdladrntsafrrmaevlnssnddyirtseerhykasqaiwqamvangdiykgg
    yagwysvewveeesyffrlsayqdklldlyennpgfimpaerrneivsfvksglkdlsis
    rttfdwgipvpgdekhvmyvwvdaltnyitalgypdttderwaywpanahiigkdisrfh
    avywpaflmsaqlplpkrvfahgflfnridpfelverygldqlryflmrevpfgqdgsys
    heaivnrtnadlandlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaletar
    kamddqalhlalgaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgimv
    qpfipqsaeklldilavpadkrqfadvlasplaggtdlpapqpvfpry