PDB entry 4dl0

View 4dl0 on RCSB PDB site
Description: Crystal Structure of the heterotrimeric EGChead Peripheral Stalk Complex of the Yeast Vacuolar ATPase
Class: hydrolase
Keywords: coiled-coil, heterotrimer, peripheral stalk, stator complex, hydrolase, ion transport, Vacuolar ATPase, vacuolar membrane
Deposited on 2012-02-05, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: V-type proton ATPase subunit C
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: VAT3, VATC, VMA5, YKL080W, YKL410
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31412 (10-End)
      • expression tag (5-9)
  • Chain 'E':
    Compound: V-type proton ATPase subunit E
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: O6241, VAT5, VMA4, YOR332W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dl0e1, d4dl0e2
  • Chain 'G':
    Compound: V-type proton ATPase subunit G
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: VMA10, YHR039BC, YHR039C-A, YHR039C-B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dl0g_
  • Chain 'I':
    Compound: V-type proton ATPase subunit C
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: VAT3, VATC, VMA5, YKL080W, YKL410
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31412 (10-End)
      • expression tag (5-9)
  • Chain 'J':
    Compound: V-type proton ATPase subunit E
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: O6241, VAT5, VMA4, YOR332W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dl0j1, d4dl0j2
  • Chain 'K':
    Compound: V-type proton ATPase subunit G
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: VMA10, YHR039BC, YHR039C-A, YHR039C-B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dl0k_
  • Heterogens: SO4, PBM, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4dl0E (E:)
    mssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidg
    nfksklkkamlsqqitkstiankmrlkvlsareqsldgifeetkeklsgiannrdeykpi
    lqsliveallkllepkaivkalerdvdliesmkddimreygekaqrapleeivisndyln
    kdlvsggvvvsnasdkieinntleerlkllseealpairlelygpsktrkffd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dl0E (E:)
    ssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidgn
    fksklkkamlsqqitkstiankmrlkvlsareqsldgifeetkeklsgiannrdeykpil
    qsliveallkllepkaivkalerdvdliesmkddimreygekaqrapleeivisndylnk
    dlvsggvvvsnasdkieinntleerlkllseealpairlelyg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4dl0G (G:)
    gpkvpmsqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelk
    efeqknaggvgelekkaeagvqgelaeikkiaekkkddvvkilietvikpsaevhinal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dl0G (G:)
    sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqkn
    aggvgelekkaeagvqgelaeikkiaekkkddvvkilietvikps
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4dl0J (J:)
    mssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidg
    nfksklkkamlsqqitkstiankmrlkvlsareqsldgifeetkeklsgiannrdeykpi
    lqsliveallkllepkaivkalerdvdliesmkddimreygekaqrapleeivisndyln
    kdlvsggvvvsnasdkieinntleerlkllseealpairlelygpsktrkffd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dl0J (J:)
    ssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidgn
    fksklkkamlsqqitkstiankmrlkvlsareqsldgifeetkeklsgiannrdeykpil
    qsliveallkllepkaivkalerdvdliesmkddimreygekaqrapleeivisndylnk
    dlvsggvvvsnasdkieinntleerlkllseealpairlelyg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4dl0K (K:)
    gpkvpmsqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelk
    efeqknaggvgelekkaeagvqgelaeikkiaekkkddvvkilietvikpsaevhinal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dl0K (K:)
    sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqle
    kkaeagvqgelaeikkiaekkkddvvkilietvikps