PDB entry 4dkx

View 4dkx on RCSB PDB site
Description: Crystal Structure of the Rab 6A'(Q72L)
Class: protein transport
Keywords: GTP binding fold, Membrane trafficking, GTP, Cytosol, PROTEIN TRANSPORT
Deposited on 2012-02-04, released 2012-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-6A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB6A, RAB6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20340
      • see remark 999 (61)
      • engineered mutation (71)
      • see remark 999 (86-87)
    Domains in SCOPe 2.06: d4dkxa_
  • Chain 'B':
    Compound: Ras-related protein Rab-6A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB6A, RAB6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20340
      • see remark 999 (61)
      • engineered mutation (71)
      • see remark 999 (86-87)
    Domains in SCOPe 2.06: d4dkxb_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dkxA (A:)
    mstggdfgnplrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledr
    tirlqlwdtaglerfrslipsyirdsaaavvvyditnvnsfqqttkwiddvrtergsdvi
    imlvgnktdladkrqvsieegerkakelnvmfietsakagynvkqlfrrvaaalpgmest
    qdrsredmidiklekpqeqpvseggcsclehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dkxA (A:)
    kfklvflgeqsvgktslitrfmydsfdflsktmyledrtirlqlwdtaglerfrslipsy
    irdsaaavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdladkrqvsieege
    rkakelnvmfietsakagynvkqlfrrvaaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dkxB (B:)
    mstggdfgnplrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledr
    tirlqlwdtaglerfrslipsyirdsaaavvvyditnvnsfqqttkwiddvrtergsdvi
    imlvgnktdladkrqvsieegerkakelnvmfietsakagynvkqlfrrvaaalpgmest
    qdrsredmidiklekpqeqpvseggcsclehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dkxB (B:)
    rkfklvflgeqsvgktslitrfmydsfidflsktmyledrtirlqlwdtaglerfrslip
    syirdsaaavvvyditnvnsfqqttkwiddvrtergsdviimlvgnktdladkrqvsiee
    gerkakelnvmfietsakagynvkqlfrrvaaalp