PDB entry 4dkn

View 4dkn on RCSB PDB site
Description: Crystal structure of amphioxus green fluorescent protein, GFPA1
Class: fluorescent protein
Keywords: chromophore, beta-can, fluorescence, fluorescent protein
Deposited on 2012-02-03, released 2013-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.192
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amphioxus green fluorescent protein, gfpa1
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_63256
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YKQ3 (Start-222)
      • chromophore (63)
      • conflict (79)
      • conflict (102)
      • conflict (205)
    Domains in SCOPe 2.06: d4dkna_
  • Chain 'B':
    Compound: amphioxus green fluorescent protein, gfpa1
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_63256
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YKQ3
      • chromophore (63)
      • conflict (79)
      • conflict (102)
      • conflict (205)
    Domains in SCOPe 2.06: d4dknb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dknA (A:)
    gshgmplpathdihlhgsinghefdmvgggkgdpnagslvttakstkgalkfspylmiph
    lgygyyqylpypdgpspfqvsmlegsgyavyrvfdfedggklstefkysyegshikadmk
    lmgsgfpddgpvmtsqivdqdgcvskktylnnntivdsfdwsynlqngkryrarvsshyi
    fdkpfsadlmkkqpvfvyrkchvkatktevtlderekafyela
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dknA (A:)
    plpathdihlhgsinghefdmvgggkgdpnagslvttakstkgalkfspylmiphlgygy
    yqylpypdgpspfqvsmlegsgyavyrvfdfedggklstefkysyegshikadmklmgsg
    fpddgpvmtsqivdqdgcvskktylnnntivdsfdwsynlqngkryrarvsshyifdkpf
    kqpvfvyrkchvkatktevtlderekafyela
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dknB (B:)
    gshgmplpathdihlhgsinghefdmvgggkgdpnagslvttakstkgalkfspylmiph
    lgygyyqylpypdgpspfqvsmlegsgyavyrvfdfedggklstefkysyegshikadmk
    lmgsgfpddgpvmtsqivdqdgcvskktylnnntivdsfdwsynlqngkryrarvsshyi
    fdkpfsadlmkkqpvfvyrkchvkatktevtlderekafyela
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dknB (B:)
    plpathdihlhgsinghefdmvgggkgdpnagslvttakstkgalkfspylmiphlgygy
    yqylpypdgpspfqvsmlegsgyavyrvfdfedggklstefkysyegshikadmklmgsg
    fpddgpvmtsqivdqdgcvskktylnnntivdsfdwsynlqngkryrarvsshyifdkpf
    sadlmkkqpvfvyrkchvkatktevtlderekafyel