PDB entry 4dkm

View 4dkm on RCSB PDB site
Description: Crystal Structure of Amphioxus GFPc1a
Class: fluorescent protein
Keywords: fluorescent protein, beta-can, chromophore
Deposited on 2012-02-03, released 2013-05-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.293
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amphioxus Green Fluorescent Protein, GFPc1a
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75523
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA3 (0-215)
      • chromophore (57)
      • conflict (120-121)
      • conflict (168)
      • conflict (181)
      • chromophore (55)
    Domains in SCOPe 2.03: d4dkma_
  • Chain 'B':
    Compound: Amphioxus Green Fluorescent Protein, GFPc1a
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75523
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA3 (0-215)
      • chromophore (57)
      • conflict (120-121)
      • conflict (168)
      • conflict (181)
      • chromophore (55)
    Domains in SCOPe 2.03: d4dkmb_
  • Chain 'C':
    Compound: Amphioxus Green Fluorescent Protein, GFPc1a
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75523
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA3 (0-215)
      • chromophore (57)
      • conflict (120-121)
      • conflict (168)
      • conflict (181)
      • chromophore (55)
    Domains in SCOPe 2.03: d4dkmc_
  • Chain 'D':
    Compound: Amphioxus Green Fluorescent Protein, GFPc1a
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75523
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA3 (0-215)
      • chromophore (57)
      • conflict (120-121)
      • conflict (168)
      • conflict (181)
      • chromophore (55)
    Domains in SCOPe 2.03: d4dkmd_
  • Chain 'E':
    Compound: Amphioxus Green Fluorescent Protein, GFPc1a
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75523
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA3 (0-215)
      • chromophore (57)
      • conflict (120-121)
      • conflict (168)
      • conflict (181)
      • chromophore (55)
    Domains in SCOPe 2.03: d4dkme_
  • Chain 'F':
    Compound: Amphioxus Green Fluorescent Protein, GFPc1a
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75523
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA3 (0-215)
      • chromophore (57)
      • conflict (120-121)
      • conflict (168)
      • conflict (181)
      • chromophore (55)
    Domains in SCOPe 2.03: d4dkmf_
  • Chain 'G':
    Compound: Amphioxus Green Fluorescent Protein, GFPc1a
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75523
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA3 (0-215)
      • chromophore (57)
      • conflict (120-121)
      • conflict (168)
      • conflict (181)
      • chromophore (55)
    Domains in SCOPe 2.03: d4dkmg_
  • Chain 'H':
    Compound: Amphioxus Green Fluorescent Protein, GFPc1a
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: BRAFLDRAFT_75523
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3YRA3 (0-215)
      • chromophore (57)
      • conflict (120-121)
      • conflict (168)
      • conflict (181)
      • chromophore (55)
    Domains in SCOPe 2.03: d4dkmh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dkmA (A:)
    lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
    qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
    padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
    atilqkqpmfvfrktevkasdaeinlkewqkafhdl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dkmB (B:)
    lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
    qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
    padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
    atilqkqpmfvfrktevkasdaeinlkewqkafhdl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dkmC (C:)
    lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
    qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
    padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
    atilqkqpmfvfrktevkasdaeinlkewqkafhdl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dkmD (D:)
    lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
    qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
    padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
    atilqkqpmfvfrktevkasdaeinlkewqkafhdl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dkmE (E:)
    lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
    qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
    padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
    atilqkqpmfvfrktevkasdaeinlkewqkafhdl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dkmF (F:)
    lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
    qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
    padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
    atilqkqpmfvfrktevkasdaeinlkewqkafhdl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dkmG (G:)
    lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
    qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
    padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
    atilqkqpmfvfrktevkasdaeinlkewqkafhdl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dkmH (H:)
    lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
    qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
    padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
    atilqkqpmfvfrktevkasdaeinlkewqkafhdl