PDB entry 4dki

View 4dki on RCSB PDB site
Description: Structural Insights into the Anti- Methicillin-Resistant Staphylococcus aureus (MRSA) Activity of Ceftobiprole
Class: HYDROLASE/Antibiotic
Keywords: enzyme, HYDROLASE-Antibiotic complex
Deposited on 2012-02-03, released 2012-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.176
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillin-binding protein 2'
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: mecA, SACOL0033
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dkia1, d4dkia2, d4dkia3
  • Chain 'B':
    Compound: Penicillin-binding protein 2'
    Species: Staphylococcus aureus [TaxId:93062]
    Gene: mecA, SACOL0033
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dkib1, d4dkib2, d4dkib3
  • Heterogens: RB6, BCT, CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dkiA (A:)
    maskdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqd
    rkikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsi
    hienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmd
    qnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinse
    elkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgk
    diqltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynk
    ltedkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggyn
    vtryevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaq
    isnknldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkni
    iskeninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydk
    dnpnmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dkiA (A:)
    skdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrk
    ikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihi
    enlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqn
    wvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinseel
    kqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdi
    qltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklt
    edkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvt
    ryevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqis
    nknldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniis
    keninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqetgrqigwfisydkdnp
    nmmmainvkdvqdmasynakisgkvydelyengnkkydide
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dkiB (B:)
    maskdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqd
    rkikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsi
    hienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmd
    qnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinse
    elkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgk
    diqltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynk
    ltedkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggyn
    vtryevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaq
    isnknldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkni
    iskeninlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydk
    dnpnmmmainvkdvqdkgmasynakisgkvydelyengnkkydide
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dkiB (B:)
    skdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrk
    ikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqkdqsihi
    enlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyikqqmdqn
    wvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgpinseel
    kqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkkkdgkdi
    qltidakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynklt
    edkkepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvt
    ryevvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqis
    knldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisk
    eninlltdgmqqvvnkthkediyrsyanligksgtaelkrqigwfisydkdnpnmmmain
    vkdvmasynakisgkvydelyengnkkydide