PDB entry 4dk3

View 4dk3 on RCSB PDB site
Description: Structure of Editosome protein
Class: RNA binding protein/immune system
Keywords: KREPA1, VHH, Single domain antibody, PROTEIN BINDING, RNA BINDING PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-02-03, released 2012-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single domain antibody VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DK3 (0-End)
    Domains in SCOPe 2.07: d4dk3a1, d4dk3a2
  • Chain 'B':
    Compound: single domain antibody VHH
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4DK3 (0-End)
    Domains in SCOPe 2.07: d4dk3b1, d4dk3b2
  • Chain 'C':
    Compound: RNA-editing complex protein MP81
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: RNA-editing complex protein MP81
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dk3A (A:)
    qvqlqesggglvqaggslrlscaasgrtsslysmgwfrqapgkerefvaaisrngantyy
    tdsvkgrftisrdnakntvelqmnslkpedtavyycaadrfptmevvtimtneydywgqg
    tqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dk3A (A:)
    qvqlqesggglvqaggslrlscaasgrtsslysmgwfrqapgkerefvaaisrngantyy
    tdsvkgrftisrdnakntvelqmnslkpedtavyycaadrfptmevvtimtneydywgqg
    tqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dk3B (B:)
    qvqlqesggglvqaggslrlscaasgrtsslysmgwfrqapgkerefvaaisrngantyy
    tdsvkgrftisrdnakntvelqmnslkpedtavyycaadrfptmevvtimtneydywgqg
    tqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dk3B (B:)
    qvqlqesggglvqaggslrlscaasgrtsslysmgwfrqapgkerefvaaisrngantyy
    tdsvkgrftisrdnakntvelqmnslkpedtavyycaadrfptmevvtimtneydywgqg
    tqvtvss
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.